PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009593119.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 301aa    MW: 33846.6 Da    PI: 5.9216
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009593119.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.59.9e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed++l+  +++ G g+W++ ++  g+ R++k+c++rw +yl
   XP_009593119.1 16 KGPWTPAEDLKLISFIQKNGHGNWRSLPKQAGLLRCGKSCRLRWINYL 63
                     79******************************99************97 PP

2Myb_DNA-binding53.55.4e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +++++  lG++ W++Ia++++ gRt++++k+ w+++l
   XP_009593119.1  69 RGNFTPEEEDTIIKLHDSLGNR-WSKIASYLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-24766IPR009057Homeodomain-like
PROSITE profilePS5129416.3781163IPR017930Myb domain
SuperFamilySSF466898.8E-3114110IPR009057Homeodomain-like
SMARTSM007171.7E-121565IPR001005SANT/Myb domain
PfamPF002497.5E-151663IPR001005SANT/Myb domain
CDDcd001679.05E-101863No hitNo description
PROSITE profilePS5129426.18464118IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-2767117IPR009057Homeodomain-like
SMARTSM007173.1E-1568116IPR001005SANT/Myb domain
PfamPF002496.5E-1669114IPR001005SANT/Myb domain
CDDcd001674.32E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGKGRAPCCD KSKVKKGPWT PAEDLKLISF IQKNGHGNWR SLPKQAGLLR CGKSCRLRWI  60
NYLRPDVKRG NFTPEEEDTI IKLHDSLGNR WSKIASYLPG RTDNEIKNVW NTHLKKRVGI  120
LKKEIKITTT TQEAFETNNK GQYIDVATSL TEEATASAAG SCSPTSSYGS LNLCNLSTEH  180
VRAAEARDNQ DQVINEIPSD SAGADIDFWD MLDTDLSPDL DYSKVLDINL HSDQSQLQAP  240
HYTHESSSDK YDECQKWLRY LEIELGLTQT STTTTTTYTG ANYYECCDGF TSQDQNNTMQ  300
V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27161187108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00144DAPTransfer from AT1G16490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2448031e-36AC244803.1 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-8f2 map 10, complete sequence.
GenBankAC2449371e-36AC244937.1 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone sle-8f2 map 10, complete sequence.
GenBankHG9754491e-36HG975449.1 Solanum pennellii chromosome ch10, complete genome.
GenBankHG9755221e-36HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009593119.10.0PREDICTED: myb-related protein Myb4
TrEMBLK4CX871e-88K4CX87_SOLLC; Uncharacterized protein
STRINGSolyc10g005550.1.13e-88(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.19e-77myb domain protein 58